- Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1067140
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 9,312 Da
- E Coli or Yeast
- 30713
- dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
- CDG1U
- Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
Sequence
ATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ